Specifications

Variant Details
Catalog ID207480-ML490-100ULSupplier Catalog ID207480-ML490-100UL
Size100 µlPrice N/A
Supplier N/A Package Content Mouse Anti-Human AKAP7 (MaxLight™490) mAb SKU:207480-ML490, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsFLISA, Western BlotClone No.2B3
ConjugatedConjugatedConjugate TypeMaxLight
Specific ConjugateMaxLight™490IsotypeIgG
ImmunogenRecombinant protein corresponding to aa1-81 from full-length human AKAP7 with GST tagGeneAKAP7
FormLiquidShipping TemperatureBlue Ice
Storage & Handling4°C. Do Not FreezeStorage BufferPBS, pH 7.2. No preservative added.
PurityPurified

Description

MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.

This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined.

Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.