Specifications

Variant Details
Catalog ID125455-ML550-100ULSupplier Catalog ID125455-ML550-100UL
Size100 µlPrice N/A
Supplier N/A Package Content Mouse Anti-Human CTNNB1 (MaxLight™550) mAb SKU:125455-ML550, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsFLISA, Immunofluorescence, Western BlotClone No.1C9
ConjugatedConjugatedConjugate TypeMaxLight
Specific ConjugateMaxLight™550IsotypeIgG
ImmunogenPartial recombinant corresponding to aa682-781 from human CTNNB1 (AAH58926) with GST tagPurification MethodPurified by Protein A affinity chromatography.
GeneCTNNB1UniProtKBP35222
GenBank Accession No.NM_001904Protein Accession No.AAH58926
FormLiquidShipping TemperatureBlue Ice
Storage & Handling4°C. Do Not FreezeStorage BufferPBS, pH 7.2. No preservative added.
PurityAffinity Purified

Description

MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.

Catenin is one of the key downstream effectors in the Wnt signaling pathway. It has been implicated to play an important role in early embryonic development and tumorigenesis. b-catenin can be destabilized by GSK-3b or other kinases by phosphorylating it at serines 33, 37, 45 and threonine 41. Mutations of these phosphorylation sites in b-catenin have been found in many tumor cell lines.

Applications:
Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.