Specifications

Variant Details
Catalog ID130874-PE-100ULSupplier Catalog ID130874-PE-100UL
Size100 µlPrice N/A
Supplier N/A Package Content Mouse Anti-Human PARD3 (PE) mAb SKU:130874-PE, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Western BlotClone No.4G5
ConjugatedConjugatedConjugate TypePE (Phycoerythrin)
IsotypeIgGImmunogenPartial recombinant corresponding to aa181-290 from human PARD3 (AAH11711) with GST tag
Purification MethodPurified by Protein A affinity chromatography.GenePARD3
Protein Accession No.BC011711, AAH11711FormLiquid
Shipping TemperatureBlue IceStorage & Handling4°C. Do Not Freeze
Storage BufferPBS, pH 7.2. No preservative added.PurityAffinity Purified

Description

Adapter protein involved in asymmetrical cell division and cell polarization processes. Seems to play a central role in the formation of epithelial tight junctions. Targets the phosphatase PTEN to cell junctions. Association with PARD6B may prevent the interaction of PARD3 with F11R/JAM1, thereby preventing tight junction assembly. The PARD6-PARD3 complex links GTP-bound Rho small GTPases to atypical protein kinase C proteins. Required for establishment of neuronal polarity and normal axon formation in cultured hippocampal neurons.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
KIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNRSTPS

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.