Specifications

Variant Details
Catalog ID131719-APC-100ULSupplier Catalog ID131719-APC-100UL
Size100 µlPrice N/A
Supplier N/A Package Content Mouse Anti-Human PPP2R3B (APC) mAb SKU:131719-APC, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Immunoprecipitation, Western BlotClone No.2E12
ConjugatedConjugatedConjugate TypeAPC (Allophycocyanin)
IsotypeIgGImmunogenFull-length recombinant corresponding to aa1-226 from human PPP2R3B (AAH11180) with GST tag
Purification MethodPurified by Protein A affinity chromatography.GenePPP2R3B
Protein Accession No.BC011180, AAH11180FormLiquid
Shipping TemperatureBlue IceStorage & Handling4°C. Do Not Freeze
Storage BufferPBS, pH 7.2. No preservative added.PurityAffinity Purified

Description

The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.

Applications:
Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL*

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.