Specifications

Variant Details
Catalog ID131994-ML490-100ULSupplier Catalog ID131994-ML490-100UL
Size100 µlPrice N/A
Supplier N/A Package Content Mouse Anti-Human PSME2 (MaxLight™490) mAb SKU:131994-ML490, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsFLISA, Immunohistochemistry, Immunoprecipitation, Western BlotClone No.1G4
ConjugatedConjugatedConjugate TypeMaxLight
Specific ConjugateMaxLight™490IsotypeIgG
ImmunogenPartial recombinant corresponding to aa1-91, from human PSME2 (NP_002809) with GST tagPurification MethodPurified by Protein A affinity chromatography.
GenePSME2UniProtKBQ9UL46
GenBank Accession No.NM_002818FormLiquid
Shipping TemperatureBlue IceStorage & Handling4°C. Do Not Freeze
Storage BufferPBS, pH 7.2. No preservative added.PurityAffinity Purified

Description

MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.

Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.

Applications:
Suitable for use in FLISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 6ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMETDKQEKKEVHK

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.