Specifications

Variant Details
Catalog ID133045-100UGSupplier Catalog ID133045-100UG
Size100 µgPrice N/A
Supplier N/A Package Content Mouse Anti-Human SCUBE3 mAb SKU:133045, 100ug
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Western BlotClone No.1D6
IsotypeIgGImmunogenPartial recombinant protein corresponding to aa29-148 from human SCUBE3 (AAH52263) with GST tag
Purification MethodPurified by Protein A affinity chromatography.GeneSCUBE3
Protein Accession No.BC052263, AAH52263.2FormLiquid
Shipping TemperatureBlue IceStorage & Handling-20°C
Storage BufferPBS, pH 7.2.PurityAffinity Purified

Description

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
DVDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGNGGCQQSCVNMMGSYECHCREGFFLSDN

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

For research use only.