Specifications

Variant Details
Catalog ID133610-ML750-100ULSupplier Catalog ID133610-ML750-100UL
Size100 µlPrice N/A
Supplier N/A Package Content Mouse Anti-Human SNAPAP (MaxLight™750) mAb SKU:133610-ML750, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsFLISA, Immunohistochemistry, Western BlotClone No.3H1
ConjugatedConjugatedConjugate TypeMaxLight
Specific ConjugateMaxLight™750IsotypeIgG
ImmunogenPartial recombinant corresponding to aa41-137 from SNAPAP (NP_036569) with GST tagPurification MethodPurified by Protein A affinity chromatography.
GeneSNAPAPProtein Accession No.NP_036569
FormLiquidShipping TemperatureBlue Ice
Storage & Handling4°C. Do Not FreezeStorage BufferPBS, pH 7.2. No preservative added.
PurityAffinity Purified

Description

MaxLight™750 is a new Near IR stable dye conjugate comparable to DyLight™750, Alexa Fluor™700 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (759nm); Emission (780nm); Extinction Coefficient 240,000.

May modulate a step between vesicle priming, fusion and calcium-dependent neurotransmitter release by potentiating the interaction of synaptotagmins with the SNAREs and the plasma-membrane-associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. May also have a role in the mechanisms of SNARE-mediated membrane fusion in non-neuronal cells.

Applications:
Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
DSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK*

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.