Specifications

Variant Details
Catalog ID133774-AP-100ULSupplier Catalog ID133774-AP-100UL
Size100 µlPrice N/A
Supplier N/A Package Content Mouse Anti-Human SPINK1 (AP) mAb SKU:133774-AP, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Immunohistochemistry, Immunoprecipitation, Western BlotClone No.4D4
ConjugatedConjugatedConjugate TypeAP (Alkaline Phosphatase)
IsotypeIgGImmunogenPartial recombinant corresponding to aa24-80 from human SPINK1 (AAH25790) with GST tag
Purification MethodPurified by Protein A affinity chromatography.GeneSPINK1
Protein Accession No.BC025790, AAH25790FormLiquid
Shipping TemperatureBlue IceStorage & Handling4°C. Do Not Freeze
Storage BufferPBS, pH 7.2. No preservative added.PurityAffinity Purified

Description

This is a trypsin inhibitor, its physiological function is to prevent the trypsin-catalyzed premature activation of zymogens within the pancreas.

Applications:
Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC*

Storage and Stability:
Store product at 4°C. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.