Specifications

Variant Details
Catalog ID134951-Biotin-100ULSupplier Catalog ID134951-Biotin-100UL
Size100 µlPrice N/A
Supplier N/A Package Content Mouse Anti-Human TYK2 (Biotin) mAb SKU:134951-Biotin, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western BlotClone No.6G12
ConjugatedConjugatedConjugate TypeBiotin
IsotypeIgGImmunogenPartial recombinant corresponding to aa276-375 from human TYK2 (AAH14243) with GST tag
Purification MethodPurified by Protein A affinity chromatography.GeneTYK2
Protein Accession No.BC014243, AAH14243FormLiquid
Shipping TemperatureBlue IceStorage & Handling-20°C
Storage BufferPBS, pH 7.2. No preservative added.PurityAffinity Purified

Description

Applications:
Suitable for use in Immunofluorescence, ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWA

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 

Note: Applications are based on unconjugated antibody.

For research use only.