Specifications

Variant Details
Catalog ID135805-Biotin-100ULSupplier Catalog ID135805-Biotin-100UL
Size100 µlPrice N/A
Supplier N/A Package Content Mouse Anti-Human ZNF8 (Biotin) mAb SKU:135805-Biotin, 100ul
General
ClonalityMonoclonalHostMouse
ReactivityHumanCross ReactivityHuman
ApplicationsELISA, Western BlotClone No.2C6
ConjugatedConjugatedConjugate TypeBiotin
IsotypeIgGImmunogenPartial recombinant corresponding to aa82-181 of human ZNF8 (NP_066575) with GST tag
Purification MethodPurified by Protein A affinity chromatography.GeneZNF8
Protein Accession No.NP_066575FormLiquid
Shipping TemperatureBlue IceStorage & Handling-20°C
Storage BufferPBS, pH 7.2. No preservative added.PurityAffinity Purified

Description

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
ELWVAERGTTQGCHPAWEPRSESQASRKEEGLPEEEPSHVTGREGFPTDAPYPTTLGKDRECQSQSLALKEQNNLKQLEFGLKEAPVQDQGYKTLRLRE*

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 

Note: Applications are based on unconjugated antibody.

For research use only.