Specifications

Variant Details
Catalog ID247772-ML490-100ULSupplier Catalog ID247772-ML490-100UL
Size100 µlPrice N/A
Supplier N/A Package Content Mouse Anti- JAG1 (MaxLight™490) mAb SKU:247772-ML490, 100ul
General
ClonalityMonoclonalHostMouse
ApplicationsFLISA, Western BlotClone No.1B7
ConjugatedConjugatedConjugate TypeMaxLight
Specific ConjugateMaxLight™490IsotypeIgG
ImmunogenJAG1 (NP_000205, 905aa-1014aa) full length recombinant protein with GST tagGeneJAG1
Protein Accession No.NP_000205FormLiquid
Shipping TemperatureBlue IceStorage & Handling4°C. Do Not Freeze
Storage BufferPBS, pH 7.2. No preservative added.PurityPurified

Description

MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.

The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter a human homolog of the Drosophilia jagged receptor notch. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis. [provided by RefSeq

Applications:
Suitable for use in FLISA, Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
HKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHV

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

For research use only.